PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000967.1.g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family LBD
Protein Properties Length: 305aa    MW: 33334.2 Da    PI: 9.41
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000967.1.g00007.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26078.41.2e-243010525100
                          DUF260  25 eqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                                     ++p++ anvhk+FGasnv k+l++l+  +reda++sl+yeAear+rdPvyG+vg+i+ lqq+l+q++ +l  +++e
  FANhyb_rscf00000967.1.g00007.1  30 TSPRNSANVHKVFGASNVAKILNELSAPQREDAVNSLAYEAEARLRDPVYGCVGLISILQQRLKQVQLDLYNARKE 105
                                     5678899************************************************************999888776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089113.8014106IPR004883Lateral organ boundaries, LOB
PfamPF031953.1E-2331102IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MKLTQANTPA SFSGGNAPRS VCSRRTSRRT SPRNSANVHK VFGASNVAKI LNELSAPQRE  60
DAVNSLAYEA EARLRDPVYG CVGLISILQQ RLKQVQLDLY NARKELAAYM GPQAMLSILQ  120
PASYMGPQQI QGGNAGTSSA VVPYNMSPMM GIPTGGGSSG QLMVREQQQQ QQMFEAQQLL  180
AAREQQEMLR SFEQNKQSQA GHHQLRFNSG FDSVTGTGLS QMSPTSSAAA NNANISPALA  240
LGFDHSPYQI QQQQQEHHHH HLQLQALLQS QQQQSQQPQQ QQPPQLLPHK VEGEEGRSRS  300
VGPSC
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004288064.11e-135PREDICTED: LOB domain-containing protein 36
SwissprotQ9FKZ31e-56LBD36_ARATH; LOB domain-containing protein 36
TrEMBLM5W6J83e-88M5W6J8_PRUPE; Uncharacterized protein
STRINGVIT_07s0197g00020.t011e-70(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.12e-52ASYMMETRIC LEAVES 2-like 1